DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG18223

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:267 Identity:54/267 - (20%)
Similarity:101/267 - (37%) Gaps:68/267 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CSGTLINHLFVLTAAHCVPD-------DLLITVRLGEYN-------TKTKVDCDNHLCQEPFQEY 111
            |.|.:|:..::||:|||..|       ..::.|..|..|       ....::.......:.|..:
  Fly    79 CGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKFTVF 143

  Fly   112 NVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRE-- 174
            |               ||:|.::.|.:::...|   |:....:....:|...|. :|...|..  
  Fly   144 N---------------TNNIALMMLAKKLPLDN---PLVGVINLPTADPEPGLN-YTVLGWGRIF 189

  Fly   175 TAANATSKVLRTMNIDRQPKETCSE---IYGWNMTFEQICAGNTLSQL----CSTDSGAPQIRKM 232
            ......|.:|. ::::..|::.|.:   |:    ..|.:||||..:.:    |:.|:|:|.|...
  Fly   190 KGGPLASDILH-IDVELLPRDICEKKVHIF----KEEMMCAGNLNNTMDENPCAGDTGSPLIFNE 249

  Fly   233 WHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWIKRVVRQ-------YGPS---TDM----- 282
            ...|...| ::|..|:..     ..|..::..:.|||..::..       |.|:   |.:     
  Fly   250 TVFGVVSY-RVGCGSKTL-----PSIYTNVYMHMDWINGIMNNNEANRLCYSPNYLFTTIGIIIG 308

  Fly   283 NRSLKKW 289
            |:.||.|
  Fly   309 NKILKSW 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 47/233 (20%)
Tryp_SPc 48..269 CDD:214473 45/230 (20%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 47/233 (20%)
Tryp_SPc 60..280 CDD:214473 45/230 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437340
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.