DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG6865

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:302 Identity:74/302 - (24%)
Similarity:120/302 - (39%) Gaps:57/302 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IIGIAVICCLWRRVQGFQMLLEEDCGIPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHL 69
            |:.:..:..|.:..|.......:.|.:.:........|:..:.|:|..|....|..|.||:|:..
  Fly     4 IVFVVAVLSLVKCAQSQIAFSNQPCSVRNPKIVGGSEAERNEMPYMVSLMRRGGHFCGGTIISER 68

  Fly    70 FVLTAAHCVPDDL--------------LITVR-----LGEYNTKTKVDCDNHLCQEPFQEYNVDM 115
            ::|||.||:.:.|              |.::|     :|......:||..|.:            
  Fly    69 WILTAGHCICNGLQQFMKPAQIQGVVGLHSIREYLNGIGNGPDALRVDFKNIV------------ 121

  Fly   116 GFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRET----A 176
              .|..|:.||..:||.:|.|.:.:.:.:||:|.|: .|......::| .:.|.:.|..|    |
  Fly   122 --PHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCV-GSEEGHRSLEQ-EYGTVSGWGWTHENQA 182

  Fly   177 ANATSKVLRTMNIDRQPKETCSEIY---GWNMTF--EQICAGNTLSQL--CSTDSGAPQIRKMWH 234
            .|..|.|||...:.....|.|...|   |.:.|.  .|:|||....|:  |..|||.|.:.|..|
  Fly   183 ENDRSDVLRKATVKIWNNEACERSYRSLGKSNTIGETQLCAGYENGQIDSCWADSGGPLMSKEHH 247

  Fly   235 NGSDRYVQLGIASRVKGQCQN---SGILMDLLSYADWIKRVV 273
                   .:|:.|...| |..   .||...:..|..|:::|:
  Fly   248 -------LVGVVSTGIG-CARPGLPGIYTRVSKYVSWMQKVI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 68/256 (27%)
Tryp_SPc 48..269 CDD:214473 67/253 (26%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 68/265 (26%)
Tryp_SPc 35..280 CDD:238113 69/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.