DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG7542

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:241 Identity:68/241 - (28%)
Similarity:106/241 - (43%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AKLAQNPWMAYLETPKG---FHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHL 103
            |::.|.|:.|.|....|   ..|.||||:|.:::|||||:.....:||.||..|...:       
  Fly    33 AEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDE------- 90

  Fly   104 CQEPFQEYNVDMG--FRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEP-IDQLT 165
            .:|..:...|:..  ..|..|.|:...|||.::||...|.:.:.||...:......|.| .:.:.
  Fly    91 SEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPTYESIR 155

  Fly   166 WFTTTVWRET-AANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQ-LCSTDSGAPQ 228
            .|.:...||: |:::.|.|||.:.:...|...|...:...::.:.||...|..: .|..|||.|.
  Fly   156 AFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGDSGGPL 220

  Fly   229 IRKMWHNGSDRYVQLGIASRVKGQ---CQNS--GILMDLLSYADWI 269
            :.|   .|:..|:   |.|...|.   ||..  .:...:.||.|||
  Fly   221 VYK---QGNSSYL---IGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/235 (28%)
Tryp_SPc 48..269 CDD:214473 64/233 (27%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 68/241 (28%)
Tryp_SPc 27..260 CDD:214473 66/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.