DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG4998

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:281 Identity:72/281 - (25%)
Similarity:126/281 - (44%) Gaps:50/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPH--NISERSVN-------AKLAQNPW-MAYL-ETPKG--FHCSGTLINHLFVLTAAHCVPD 80
            ||:.:  .|:.|..|       ::..:.|| :|.| :.||.  :.|.||||:...:::||||:..
  Fly   921 CGVRNAAGITGRIKNPVYVDGDSEFGEYPWHVAILKKDPKESIYACGGTLIDAQHIISAAHCIKS 985

  Fly    81 ----DLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVE 141
                ||  .|||||::....|:.      .|:.|.:|.....|..|.|....||:.:|:|.:.|:
  Fly   986 QNGFDL--RVRLGEWDVNHDVEF------FPYIERDVVSVHIHPEYYAGTLDNDLAVLKLDQPVD 1042

  Fly   142 YLN--HIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSK---VLRTMNIDRQPKETC-SEI 200
            :..  ||.|.|:  .:::.:......|  ||.|.:.|.....|   :|:.:::.....:.| |::
  Fly  1043 FTKNPHISPACL--PDKYSDFTGARCW--TTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQL 1103

  Fly   201 ------YGWNMTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQL---GIASRVKGQCQN 255
                  |.:.:....:|||....: .|..|.|.|.:..  .||:...|.:   ||..   ||...
  Fly  1104 RNTRLGYSYKLNPGFVCAGGEEGKDACKGDGGGPLVCD--RNGAMHVVGVVSWGIGC---GQVNV 1163

  Fly   256 SGILMDLLSYADWIKRVVRQY 276
            .|:.:.:.:|..||:::.:.|
  Fly  1164 PGVYVKVSAYLPWIQQITQSY 1184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/247 (27%)
Tryp_SPc 48..269 CDD:214473 64/244 (26%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 66/254 (26%)
Tryp_SPc 942..1177 CDD:214473 64/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.