DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG10663

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:272 Identity:74/272 - (27%)
Similarity:114/272 - (41%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEEDCGIPHN-ISERSVN----------AKLAQNPW-MAYLETPKGFHCSGTLINHLFVLTAAHC 77
            |:..|||..: ...||::          |:..:.|| :|.|...|...|.||||...:|||||||
  Fly   485 LKLSCGIVRSGTGRRSMSNMLKIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHC 549

  Fly    78 VPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEY 142
            |..  ::.||:||:|...:...:..|        .|...:.|..::.....:|:.:|||.:.|..
  Fly   550 VRK--VLFVRIGEHNLNYEDGTEIQL--------RVMKSYTHPNFDKRTVDSDVALLRLPKAVNA 604

  Fly   143 LNHIRPICIFASNRFQEPIDQL---TWFTTTVW---RETAANATSKVLRTMNIDRQPKETCSEI- 200
            ...|...|:      .:|...|   ...|...|   |...|..|| ||....:...|.:.|.:: 
  Fly   605 TTWIGYSCL------PQPFQALPKNVDCTIIGWGKRRNRDATGTS-VLHKATVPIIPMQNCRKVY 662

  Fly   201 YGWNMTFEQICAGNTLSQL--CSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS--GILMD 261
            |.:.:|....|||:....:  |:.|||.|.:.:.....:..:...||.|...|..|.:  ||...
  Fly   663 YDYTITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAK 727

  Fly   262 LLSYADWIKRVV 273
            :.:|.||:..||
  Fly   728 VPNYVDWVWSVV 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 65/235 (28%)
Tryp_SPc 48..269 CDD:214473 64/232 (28%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 65/245 (27%)
Tryp_SPc 507..735 CDD:238113 65/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.