DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and proca

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_956650.1 Gene:proca / 393327 ZFINID:ZDB-GENE-060824-5 Length:434 Species:Danio rerio


Alignment Length:312 Identity:82/312 - (26%)
Similarity:128/312 - (41%) Gaps:75/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GIAVIC-CLWRRVQGFQM---------LLEEDCG---IPH------------------NISERSV 40
            |:|..| |    ::|:|:         ..:..||   ||.                  |:.:|  
Zfish   145 GLARTCSC----IKGYQLQDNSRKCTPKNDASCGQIRIPKSAYANKPKPVLQPWVMGGNVGKR-- 203

  Fly    41 NAKLAQNPWMAYLETPKG-FHCSGTLINHLFVLTAAHCVPDDLLITVRLGEY------NTKTKVD 98
                .::||.|.:....| |||.|.||:..:|||||||:......:||||:|      .::..:.
Zfish   204 ----GESPWQALILNHLGRFHCGGVLIDENWVLTAAHCLETSSKFSVRLGDYQRFKFEGSEVTLP 264

  Fly    99 CDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQ 163
            ...|:              .|..||.....|||.:|||...|::..:|.|.|:.:....:..:.:
Zfish   265 VKQHI--------------SHPQYNPITVDNDIALLRLDGPVKFSTYILPACLPSLELAKRMLHR 315

  Fly   164 LTWFT-TTVWRETAANATS--KVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQL---CST 222
            ....| .|.|.:...:|||  ..|..:.:.....:.||.....|::...:||| .|.|:   |..
Zfish   316 NGTVTIITGWGKNNQSATSYNSTLHYVELPIVDNKECSRHMMNNLSDNMLCAG-VLGQVKDACEG 379

  Fly   223 DSGAPQIRKMWHNGSDRYVQLGIASRVK--GQCQNSGILMDLLSYADWIKRV 272
            |||.|.: .::|   |.:..:|:.|..:  ||....||...:.||.|||..|
Zfish   380 DSGGPMM-TLFH---DTWFLVGLVSWGEGCGQRDKLGIYTKVASYLDWIDSV 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 69/238 (29%)
Tryp_SPc 48..269 CDD:214473 67/235 (29%)
procaNP_956650.1 GLA 23..84 CDD:214503
EGF_CA 85..119 CDD:238011
FXa_inhibition 128..165 CDD:291342 6/23 (26%)
Tryp_SPc 195..427 CDD:238113 71/256 (28%)
Tryp_SPc 197..424 CDD:214473 69/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.