DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG18180

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:229 Identity:46/229 - (20%)
Similarity:85/229 - (37%) Gaps:58/229 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNAND 126
            :||:|.:.::||||||:..|.:                :.|        |..:.|:...|.....
  Fly    67 AGTIIANDWILTAAHCLTGDYV----------------EIH--------YGSNWGWNGAYRQTVR 107

  Fly   127 QTN-------------DIGMLRLGRRVEYLNHIRPICIFASN----RFQEPIDQLTWFTTTVWRE 174
            :.|             |||::|. ..|::...|..|.:.:.|    |:|:     ||.....|..
  Fly   108 RDNFISHPDWPSQGGRDIGLIRT-PHVDFNGLINKIPLPSMNEQNDRYQD-----TWCVACGWGG 166

  Fly   175 TAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSD 238
            ......:..|:.:::.......|.:.|| ::....:|..:...: :|..|||.|.:.      .|
  Fly   167 MDNGNLADWLQCVDVQIISNSECEQAYG-SVASTDMCTRHADGKSVCGGDSGGPLVT------HD 224

  Fly   239 RYVQLGIASRVKGQCQN--SGILMDLLSYADWIK 270
            ....:|:.:.....|.:  ||... :..|.:||:
  Fly   225 NARLVGVITFASVSCHDGPSGYTR-VSDYLEWIR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 46/229 (20%)
Tryp_SPc 48..269 CDD:214473 44/226 (19%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 44/226 (19%)
Tryp_SPc 36..259 CDD:238113 46/229 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.