DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG8329

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:249 Identity:60/249 - (24%)
Similarity:99/249 - (39%) Gaps:34/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GIPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTK 94
            |.|.:|......|...:.|:...|....|....|::|.:.:|||||||:..| .:|:..|     
  Fly    29 GGPKDIIVNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCLTTD-SVTIHYG----- 87

  Fly    95 TKVDCDNHLCQEPFQE-YNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICI--FA--S 154
                 .|.......|. .|.:..|||..| .|...:|||::|. ..|.:.|.|..:.:  |:  .
  Fly    88 -----SNRAWNGQLQHTVNKNNFFRHPGY-PNSAGHDIGLIRT-PYVSFTNLINKVSLPKFSQKG 145

  Fly   155 NRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQ- 218
            .||:.     .|.....|...|....:..|:.|::.......|:..|| ::....:|...|..: 
  Fly   146 ERFEN-----WWCVACGWGGMANGGLADWLQCMDVQVISNGECARSYG-SVASTDMCTRATDGKS 204

  Fly   219 LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQN--SGILMDLLSYADWIK 270
            :|..|||...:.      .|..:|:|:.:.....|::  ||... :..:.|||:
  Fly   205 VCGGDSGGALVT------HDNPIQVGVITFASIGCKSGPSGYTR-VSDHLDWIR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 56/231 (24%)
Tryp_SPc 48..269 CDD:214473 54/228 (24%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 57/243 (23%)
Tryp_SPc 35..250 CDD:214473 55/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.