DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG33465

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:303 Identity:87/303 - (28%)
Similarity:138/303 - (45%) Gaps:25/303 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNFIIGIAVICCLWRRVQGFQMLLEEDCGIPHNISERSVNAKLAQN-PWMAYLETPKGFHCSGT 64
            :|..:||: |:|      ||...||::.|..|......:.|....:. ||||.:.....|.|.||
  Fly     5 LSLALIGL-VLC------QGLAQLLDKKCHDPKTSENINFNHGATETAPWMASIYKNNQFICDGT 62

  Fly    65 LINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTN 129
            |::.|||||||.|:..|..:.|..|.||...  |.......|   :|.|.:..:|..:..|:..|
  Fly    63 LVHKLFVLTAASCISKDSQLYVLFGMYNQYR--DASQFFNNE---QYGVAVALQHSNFRPNNGVN 122

  Fly   130 DIGMLRLGRRVEYLNHIRPICIFASNRFQE-PIDQLTWFTTTVWRETAANATSKVLRTMNIDRQP 193
            |||:|||...|.:..|||||||...:..:. |.::...|.   |::....|:|:|.:|:.:.::.
  Fly   123 DIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGFG---WQQQGTEASSQVRQTVYLSQKK 184

  Fly   194 KETC---SEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQN 255
            ...|   .::...|.  .|.||||.....|.::||:|......:...:..||:|:.|.....|..
  Fly   185 PFECHRNGQLLPINE--GQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSP 247

  Fly   256 SGILMDLLSYADWIKRVVRQY---GPSTDMNRSLKKWVDKIPV 295
            :.:..|::::.|||...||.:   |...........|.:.:.|
  Fly   248 TSVYTDVVAFKDWIYNTVRNFETKGDQVVYEECRSNWAEDVLV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 70/227 (31%)
Tryp_SPc 48..269 CDD:214473 68/224 (30%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 70/227 (31%)
Tryp_SPc 46..261 CDD:214473 68/224 (30%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463369
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.