DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG16998

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:272 Identity:69/272 - (25%)
Similarity:101/272 - (37%) Gaps:64/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISERS--------VNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCV--PDDLL 83
            ||  |..|..|        |...:...||:|.:.....:.||..||..|:::||.|||  ||.  
  Fly    12 CG--HKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQYPDS-- 72

  Fly    84 ITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRP 148
            .:||.|    .|..|...       |..||.....|..:|.....|||.:|:|.:......:|:.
  Fly    73 YSVRAG----STFTDGGG-------QRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQV 126

  Fly   149 ICIFASNRFQEPIDQLTWFTTTV----W-------RETAANATSKVLRTMNIDRQPKETCSEIYG 202
            :.:        |:..|.....|:    |       .|:.......|::.:|     :..|..:|.
  Fly   127 VKL--------PLPSLNILPRTLLVAGWGNPDATDSESEPRLRGTVVKVIN-----QRLCQRLYS 178

  Fly   203 W---NMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQN---SGILMD 261
            .   .:|.:.:||.......|..|||||.:    |.||    ..||.|...| |.:   .|:...
  Fly   179 HLHRPITDDMVCAAGAGRDHCYGDSGAPLV----HRGS----SYGIVSFAHG-CADPHFPGVYTR 234

  Fly   262 LLSYADWIKRVV 273
            |.:|..||..|:
  Fly   235 LANYVTWIFNVL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 62/242 (26%)
Tryp_SPc 48..269 CDD:214473 60/239 (25%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 61/252 (24%)
Tryp_SPc 25..242 CDD:238113 61/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.