DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and sphinx2

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:243 Identity:39/243 - (16%)
Similarity:82/243 - (33%) Gaps:83/243 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNAND 126
            :||:|::.::||    |.:.|:.......:.:|           ..|..|::...:|..:|...|
  Fly    57 AGTIISNQWILT----VKEVLIFKYIEAHFGSK-----------RAFWGYDILRIYRENFYFHYD 106

  Fly   127 QTNDIGMLR-----------------LGRRVE-YLNHIRPICIFASNRFQEPIDQLTWFTTTVWR 173
            :|..|.:::                 .|.|.| |:.::..:|.:.:::  ..:...||       
  Fly   107 KTRIIALVKCPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDK--RKVRLPTW------- 162

  Fly   174 ETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRK------- 231
                      :|.:.::......|::.:.....:|...:|.....:|..|.|...:..       
  Fly   163 ----------MRCVEVEVMNNTECAKYHTPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPNPTFI 217

  Fly   232 --MW---HNGSDRY--VQLGIASRVKGQCQNSGILMDLLSYADWIKRV 272
              :|   .|.|..|  |.:.::..:|                 |||.|
  Fly   218 GIIWLMPTNCSIGYPSVHIRVSDHIK-----------------WIKHV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 38/241 (16%)
Tryp_SPc 48..269 CDD:214473 35/238 (15%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 35/238 (15%)
Tryp_SPc 26..248 CDD:304450 38/241 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.