DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:254 Identity:52/254 - (20%)
Similarity:106/254 - (41%) Gaps:45/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ISERSVNAKLAQN--------PWMAYLETPK---GFHCSGTLINHLFVLTAAHCVPDDLLITVRL 88
            :.:.|:..::...        |::..|...|   |..|.|::|.:.:|:||.||......:|:..
  Fly    29 VGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYY 93

  Fly    89 GEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFA 153
            |.. .:.:....:.:.:..|.|:.               :.||.::|. ..|::.:.:..:.:  
  Fly    94 GAL-WRLQAQYTHWVGRSDFIEHG---------------SGDISLIRT-PHVDFWSLVNKVEL-- 139

  Fly   154 SNRFQEPID--QLTWFTTTVWRETA-ANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNT 215
             .|:.:..:  |..|...:.|.:|: ....|:.|..:::.......|...|| :.:.:.||....
  Fly   140 -PRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCENYYG-SFSGDLICIPTP 202

  Fly   216 LSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIAS-RVKGQCQNSGI--LMDLLSYADWIK 270
            .:: .||.|||.|.:   .|:|:.   |:||.| .....|.::|.  ::.:.||.|||:
  Fly   203 ENKGTCSGDSGGPLV---IHDGNR---QVGIVSFGSSAGCLSNGPKGMVRVTSYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 51/233 (22%)
Tryp_SPc 48..269 CDD:214473 49/230 (21%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 49/243 (20%)
Tryp_SPc 41..257 CDD:238113 51/242 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435613
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.