DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:288 Identity:66/288 - (22%)
Similarity:118/288 - (40%) Gaps:60/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IIGI------AVICCLWRRVQGFQMLLEEDCGIPHNISERSVNAKLAQNPWMAYLETPK------ 57
            ::|:      |::..|.|.|.      .:|....:.|:.|..|...|....:.|:...:      
  Fly     3 VLGVLLFSAFALVAALERPVP------VKDMPAGNKINGRITNGYPAYEGKVPYIVALRFDNGNG 61

  Fly    58 -GFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRY 121
             |::|.|::|.|.:|||||||......:|:..|..           ..|:|        .|.|  
  Fly    62 GGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAV-----------WRQQP--------QFTH-- 105

  Fly   122 YNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQL--TWFTTTVWRETA-ANATSKV 183
            |:..:..|||.::|. ..|::.:.:..:.:   .|:.:..:..  .|...:.|..:: ::..:..
  Fly   106 YDTGNLHNDIALIRT-PHVDFWSLVNKVEL---PRYDDRYNNFYGWWALLSGWGSSSDSSGMTDY 166

  Fly   184 LRTMNIDRQPKETCSEIYGWN-MTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIA 246
            |..::|.......|.:.||.: :|...:|.....:: .||.|||.|.:   .|:|:.   |:||.
  Fly   167 LNCVDIQISDNSVCLDYYGSHYITSNHLCYATPENKGSCSGDSGGPLV---LHDGNR---QVGIV 225

  Fly   247 S--RVKGQCQNS--GILMDLLSYADWIK 270
            |  ...|...||  | |..:..|.|||:
  Fly   226 SFGSAAGCLSNSPKG-LTRVTGYLDWIR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 56/239 (23%)
Tryp_SPc 48..269 CDD:214473 54/236 (23%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 57/246 (23%)
Tryp_SPc 37..254 CDD:238113 58/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.