DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:265 Identity:69/265 - (26%)
Similarity:109/265 - (41%) Gaps:60/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NISERSVNAKLA---QNPW---MAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYN 92
            ||..|..|.|.|   |.|:   :::..|...:.|.|::|::.:|||||||......:|:..|. .
  Fly    35 NIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGA-T 98

  Fly    93 TKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFAS--N 155
            .:|..        :..|..:.|...:|..||:....|||.:::           .|...|.:  |
  Fly    99 VRTSA--------QLVQTVSADNFVQHASYNSIVLRNDISLIK-----------TPTVAFTALIN 144

  Fly   156 RFQEPIDQLTWFTTT-------VWRETAANATS-------KVLRTMNIDRQPKETCSEIYGWNM- 205
            :.:.|....|:.|.|       .|.:|:.:|||       :|...:::.:     |...||..: 
  Fly   145 KVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQ-----CQNTYGSLVA 204

  Fly   206 TFEQICAG--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGI---LMDLLSY 265
            |...||..  |.:| .|:.|||.|.:..     ||..: :|:.|.|......||.   ...:.||
  Fly   205 TNNVICVATPNKVS-TCNGDSGGPLVLV-----SDSKL-IGVTSFVSSAGCESGAPAGFTRVTSY 262

  Fly   266 ADWIK 270
            .||||
  Fly   263 LDWIK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 62/248 (25%)
Tryp_SPc 48..269 CDD:214473 59/245 (24%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 64/258 (25%)
Tryp_SPc 40..269 CDD:238113 66/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.