DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:246 Identity:56/246 - (22%)
Similarity:96/246 - (39%) Gaps:38/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NAKLAQNPWMA----YLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDN 101
            ||.:.|.|:..    .|.......|.|:||...:|||||||......:||.||. ..:|..:..:
  Fly    43 NAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGA-TVRTSAEITH 106

  Fly   102 HLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRL-----GRRVEYLNHIRPICIFASNRFQEPI 161
            .:.....        ..|..:|:.:..|||.::::     ..|:..:. :..|    ||.:...:
  Fly   107 TVSSSDI--------IIHSGWNSANLRNDISLIKIPATSSSSRISAVK-LPSI----SNSYSTFV 158

  Fly   162 DQLTWFTTTVWRETAANATSKVLRTMNIDRQ--PKETCSEIYGWN-MTFEQICAGNT-LSQLCST 222
            ..:.  ..:.|..|:..::........:|..  ....|::.||.: :|...:|...| ....|:.
  Fly   159 GDVA--VASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNG 221

  Fly   223 DSGAPQIRKMWHNGSDRYVQLGIAS-RVKGQCQNS--GILMDLLSYADWIK 270
            |||.|.:.|   :.|:   |:|:.| .....|:..  .....:.||.||||
  Fly   222 DSGGPLVLK---SSSE---QIGLTSFGASAGCEKGYPAAFTRVTSYLDWIK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 53/239 (22%)
Tryp_SPc 48..269 CDD:214473 50/236 (21%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 53/243 (22%)
Tryp_SPc 38..268 CDD:238113 56/246 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.