DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and yip7

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:255 Identity:62/255 - (24%)
Similarity:103/255 - (40%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NISERSVNAKLA---QNPW---MAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYN 92
            :|:.|..|.|.|   |.|:   :::..:...:.|.|::|.:.:|||||||......:|:..|. .
  Fly    35 SITGRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGA-T 98

  Fly    93 TKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFA-SNR 156
            .:|..:....:....|::        |..|.|....|||.:::.. .|.:...:..|.:.| ||.
  Fly    99 VRTSPEFTQVVSSSKFRQ--------HESYLALTIRNDISLIQTS-SVSFSATVNKISLPAVSNS 154

  Fly   157 FQEPIDQLTWFTTTV----WRETA--ANATSKVLRTMNIDRQPKETCSEIYG-WNMTFEQICAGN 214
            :.      |:...|.    |..|:  |.|.|:.|:.:::.......|.|.:| ..:|...:|...
  Fly   155 YS------TYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDT 213

  Fly   215 T-LSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSG---ILMDLLSYADWIK 270
            | .:..|..|||.|    :..:|    |.:|..|........||   ....:..|.||||
  Fly   214 TNKASTCQGDSGGP----LALDG----VLIGATSFGSADGCESGAPAAFTRITYYRDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 56/238 (24%)
Tryp_SPc 48..269 CDD:214473 53/235 (23%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 58/248 (23%)
Tryp_SPc 40..267 CDD:238113 60/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.