DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG10477

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:266 Identity:57/266 - (21%)
Similarity:103/266 - (38%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EDCGIPHNISERSVNAKLA---QNPW---MAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLIT 85
            :...:| :|..|..|...|   |.|:   :::..:...:.|.|::|.:.:|||||||......:|
  Fly    29 DSSAVP-SIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVT 92

  Fly    86 VRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPIC 150
            :..|. ..:|.......:....|        .:|..|||....|||.:::           .|..
  Fly    93 IYYGS-TVRTSAKLKKKVSSSKF--------VQHAGYNAATLRNDISLIK-----------TPSV 137

  Fly   151 IF--ASNRFQEPIDQLTWFT----TTV---WRETAAN--ATSKVLRTMNIDRQPKETCSEIYGWN 204
            .|  :.|:...|....::.|    |.|   |..|:.:  |.:..|:...........|.:.:|.:
  Fly   138 TFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSS 202

  Fly   205 MTFEQICAGNTLSQ--LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQ-CQNSGI--LMDLLS 264
            :....:....::::  .|..|||.|...      ::|.:  |:.|.|..: |:.:..  ...:.|
  Fly   203 VVTSGVICVESINKKSTCQGDSGGPLAL------NNRLI--GVTSFVSSKGCEKNAPAGFTRVTS 259

  Fly   265 YADWIK 270
            |.||||
  Fly   260 YLDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 51/242 (21%)
Tryp_SPc 48..269 CDD:214473 48/239 (20%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 52/252 (21%)
Tryp_SPc 40..267 CDD:238113 54/254 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436207
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.