DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG15873

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:274 Identity:63/274 - (22%)
Similarity:101/274 - (36%) Gaps:63/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FQMLLEEDCGIPHNISERSVNAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLI 84
            |:||:........|...|.|.:...:|    |:......| |||.|::...|||||||:.|....
  Fly    32 FEMLISGGYKPKSNRLSRHVVSIRTKN----YVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKA 92

  Fly    85 TV-------------RLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRL 136
            ::             ||..|:.......|..:....::.|               :.||:.:|||
  Fly    93 SMNPRGIRVVFGHITRLAVYDESDFRSVDRLVVHPEYERY---------------KKNDLAILRL 142

  Fly   137 GRRVEYLNH-IRPICIFASNRFQEPIDQLTWFTTTV---WRETAANAT-SKVLRTMNIDRQPKET 196
            ..||:..|| :.|:       .......:|:..|.:   |.:...:.. |..|..:::..:|...
  Fly   143 SERVQSSNHDVLPL-------LMRKTANVTYGDTCITLGWGQIYQHGPYSNELVYLDVILRPPSL 200

  Fly   197 CSEIYGWNMTFEQIC---AGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGI 258
            |.:.|........:|   .|.:::  |:.|.|.|.:.|    |:    ..|:.....| |. .|.
  Fly   201 CQKHYDTFTADHNVCTEPVGESMN--CAGDMGGPLLCK----GA----LFGLIGGHMG-CA-GGK 253

  Fly   259 LMDLLS---YADWI 269
            .|..||   |.|||
  Fly   254 AMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 56/247 (23%)
Tryp_SPc 48..269 CDD:214473 54/245 (22%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 51/250 (20%)
Tryp_SPc 59..250 CDD:238113 47/223 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.