DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG32270

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:251 Identity:61/251 - (24%)
Similarity:107/251 - (42%) Gaps:57/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PWMAYLETPKGFHCSGTLINHLFVLTAAHCV----PDDLLITVRLGEYNTKTKVDCDNHLCQEPF 108
            |.|..:.....|.|.|:|:....|||||||:    |.|.:  ||.|                   
  Fly    43 PHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFV--VRGG------------------- 86

  Fly   109 QEYNVDMGFRHRY---------YNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQL 164
            ..|..||. ..||         |:.....:|:.:|:|.:.:: .:..:||.:  :.|...|   .
  Fly    87 VTYLSDMR-NSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQ-ASIAKPISL--AVRSPRP---G 144

  Fly   165 TWFTTTVWRETAANATS--KVLRTMNIDRQPKETCSEIY-GW-NMTFEQICAG-NTLSQLCSTDS 224
            ::...:.|..|.:::||  ..|:::::...|:..|.::| |: |:|....||. ..|...|:.||
  Fly   145 SFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACAGDS 209

  Fly   225 GAPQIRKMWHNGSDRYVQLGIASRVKG-QC---QNSGILMDLLSYADWIKRVVRQY 276
            |.|.:..   ||    :.:|:.|..:. :|   .:.|:..|:...:|||...:.:|
  Fly   210 GGPVVNS---NG----ILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNIHRY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/245 (24%)
Tryp_SPc 48..269 CDD:214473 58/242 (24%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 58/242 (24%)
Tryp_SPc 31..254 CDD:238113 60/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.