DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG30414

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:305 Identity:90/305 - (29%)
Similarity:125/305 - (40%) Gaps:49/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GIAVICCLWRRVQGFQ-MLLEEDCG------IPHNISERSVNAKLAQNPWMAYLETPKGFHCSGT 64
            |:|::.|..:..:|.. .||:..||      ||  :.....:|.|..||||..:...|  .|.|:
  Fly     7 GLALLVCSIQLGEGAPGHLLDSSCGTTKPEFIP--MITGGADAGLFSNPWMVKVLGEK--LCGGS 67

  Fly    65 LINHLFVLTAAH-------------------------CVPDDL-LITVRLGEYNTK-TKVDCDNH 102
            ||...|||||||                         |||... |..:|||||:|: ...||   
  Fly    68 LITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDC--- 129

  Fly   103 LCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQE-PIDQLTW 166
             |.....|..||....|..||.| ..||||:||:...|:|.:::||||:.......| ||     
  Fly   130 -CVPKSYELAVDRKILHADYNLN-LDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPI----- 187

  Fly   167 FTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRK 231
            |..|.|..|.....|:.|:...:.......|...:...:...||||..|.|..|..|||.|...:
  Fly   188 FNITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPLSAQ 252

  Fly   232 MWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWIKRVVRQY 276
            :...||....|.|:.|.....|.:..:..::..:.|||...:..:
  Fly   253 VPFAGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVNAIEDF 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 77/251 (31%)
Tryp_SPc 48..269 CDD:214473 75/248 (30%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 78/260 (30%)
Tryp_SPc 41..290 CDD:238113 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.