DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG9897

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:58/269 - (21%)
Similarity:99/269 - (36%) Gaps:67/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVP--DDLLITVRLGEYNTKTKV 97
            |:..:||.|.|  ||.|.:.......|.|.:|:..::||||.||.  ....|.||||..:..|..
  Fly    24 INGNTVNIKDA--PWYASIIVNSKLKCGGAIISKNYILTAAKCVDGYSARSIQVRLGTSSCGTSG 86

  Fly    98 DCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPID 162
            .... :|:...          |..|::....|::.:|:....:...:.|:||     .|..:..|
  Fly    87 SIAG-ICKVKV----------HSQYSSWRFDNNLALLKTCELLNTTDEIKPI-----ERADKVPD 135

  Fly   163 QLTWFTTTVWRETAANATSKVLRTMNIDRQPKETC----SEIYG--------------W------ 203
            ..:....|.....:.|....:| .:.|....:|.|    .:::|              |      
  Fly   136 DNSRANVTGCGGRSGNFLDLIL-DLRISSGIEEKCFQLPVQLHGTQVRILSQKQCAADWKVIPFY 199

  Fly   204 ------NMTFEQICAGNTLSQLCSTDSGAPQI--RKMWHNGSDRYVQLGIASRVKGQCQNSGILM 260
                  ::|   ||..:.....||||.|:|.:  .|:          :||.||. |......:..
  Fly   200 LLKGISDLT---ICTKSPGKGACSTDRGSPLVIDNKL----------VGILSRA-GCSIKPDVYA 250

  Fly   261 DLLSYADWI 269
            ::|.:.:|:
  Fly   251 NILGHTNWL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 53/256 (21%)
Tryp_SPc 48..269 CDD:214473 52/254 (20%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 57/266 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.