DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG13527

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:284 Identity:67/284 - (23%)
Similarity:99/284 - (34%) Gaps:80/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDD---------LLITV--- 86
            :|..|:.|.....|           .:|.|.|:::.:|:||||||...         ||:..   
  Fly    46 SIRSRTPNKYFGDN-----------HYCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSP 99

  Fly    87 -RLGEYNTKTKVDCDNHLCQEPFQEYNVDMGF-RHRYYN-----------ANDQTNDIGMLRLGR 138
             || .| |..|..|      .|.....|...| .|..:|           :||..  ||.|.|.:
  Fly   100 HRL-RY-TPGKSVC------SPVSSLYVPKNFTMHNTFNMALMKLQEKMPSNDPR--IGFLHLPK 154

  Fly   139 RVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGW 203
            ....:.....:..:....|..|:....:....|..:   ||..|             |....||.
  Fly   155 EAPKIGIRHTVLGWGRMYFGGPLAVHIYQVDVVLMD---NAVCK-------------TYFRHYGD 203

  Fly   204 NMTFEQICAGN---TL-SQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKG-QCQN-SGILMDL 262
            .|    :||||   |: ::.||.|.|:|.:     :|.   |.:||.:...| .|.| ..:..|:
  Fly   204 GM----MCAGNNNWTIDAEPCSGDIGSPLL-----SGK---VVVGIVAYPIGCGCTNIPSVYTDV 256

  Fly   263 LSYADWIKRVVRQYGPSTDMNRSL 286
            .|...||:.....:...|..|.:|
  Fly   257 FSGLRWIRHTAYDWASITKTNPTL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/254 (24%)
Tryp_SPc 48..269 CDD:214473 58/251 (23%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 64/268 (24%)
Tryp_SPc 43..263 CDD:214473 62/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.