DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG10764

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:261 Identity:81/261 - (31%)
Similarity:115/261 - (44%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEEDCGIPHNISERSVNAKL-----AQNP---WMAYLETPKGFHCSGTLINHLFVLTAAHCVPDD 81
            ||..|||       |...|:     |..|   |||.:.....|.|.||:|:..|||:||||:...
  Fly    26 LETPCGI-------STRPKISGGDDAAEPNSIWMAAIFNSSDFQCGGTIIHMRFVLSAAHCLVRG 83

  Fly    82 LLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHI 146
            ..:.||||..|           ..||...:.|...|.|..:.|::..||||:|:|...:.|...:
  Fly    84 YDLYVRLGARN-----------INEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSESIVYTVRV 137

  Fly   147 RPICIFASNRFQEPIDQLTWFTTTVWRETAANATSK---VLRTMNIDRQPKETCSEIYGWNMTFE 208
            :|||||.....:..:::|..|....|    .|...|   :|:|:.:....:..|.....:|:...
  Fly   138 QPICIFLDPALKGSVEKLKTFRALGW----GNRNGKLSIMLQTIYLLHLKRNECKRKLNFNLNSR 198

  Fly   209 QICAGNTLSQLCSTDSGAPQIRKMWHNGSDRY-VQLGIASRVKGQCQNSGILMDLLSYADWIKRV 272
            |||||......|..|||.|....:....:..| |||||.|....:|:..|:..|:.||.|||...
  Fly   199 QICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYTDVTSYVDWISST 263

  Fly   273 V 273
            :
  Fly   264 I 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 73/230 (32%)
Tryp_SPc 48..269 CDD:214473 71/227 (31%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 73/237 (31%)
Tryp_SPc 38..263 CDD:238113 74/239 (31%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463365
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.