DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG4927

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:351 Identity:84/351 - (23%)
Similarity:129/351 - (36%) Gaps:138/351 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VICCLWRRVQGFQMLLEEDCGIPHNISERSV---------------------------------N 41
            ::|||                :|:|:..:|.                                 .
  Fly    60 IVCCL----------------LPNNMQPQSQQFSANIGLRRFEKECRRFNEIRTSCRTTPFIVGG 108

  Fly    42 AKLA--QNPWMAYL------ETPKGFHCSGTLINHLFVLTAAHCVP-------------DDLLIT 85
            ||.|  :.|:||.|      .:...:.|...:|:..||||||||:.             |.....
  Fly   109 AKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYV 173

  Fly    86 VRLGE--YNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQT----NDIGMLRLGRRVEYLN 144
            |||||  ||:.|    |:   .:| |::.|.....|..|..:|.|    |||.::.|.....:..
  Fly   174 VRLGELDYNSTT----DD---AQP-QDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSE 230

  Fly   145 HIRPICIFASNRFQEPID----QLT-----WFTTTVWRETAANATSKVLRTMNIDRQPKETCSEI 200
            ::.|.|:        |:|    ||.     |..|:    .:.:|:|.:|: :::||.....||:.
  Fly   231 YVAPACL--------PLDGGNEQLQVAAAGWGATS----ESGHASSHLLK-VSLDRYDVAECSQR 282

  Fly   201 YGWNMTFE-QICAG--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGI---- 258
            ....:... |:|||  :|.:..|..|||.|.           :||..|.|.:|   |..||    
  Fly   283 LEHKIDVRTQLCAGSRSTSADTCYGDSGGPV-----------FVQHPIYSCLK---QVIGITSYG 333

  Fly   259 ----LMDLLS-------YADWIKRVV 273
                :..|.|       |.|||:.:|
  Fly   334 LVCGVQGLPSVYTKVHLYTDWIENIV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 74/275 (27%)
Tryp_SPc 48..269 CDD:214473 72/272 (26%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 77/287 (27%)
Tryp_SPc 105..355 CDD:214473 75/284 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.