DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG8299

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:249 Identity:63/249 - (25%)
Similarity:97/249 - (38%) Gaps:37/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AKLAQNPWM--AYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDC-DNH 102
            |.:|..|:.  ..|||....| |.|::.....|:|||||:.         |.|.:..::.. .|.
  Fly    34 ADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIK---------GRYASYIRIVAGQNS 89

  Fly   103 LCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWF 167
            :.....|...|.....|..||.....||||::.....:||...::||.:..     |........
  Fly    90 IADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVAL-----EAPPSGAQA 149

  Fly   168 TTTVWRETAAN--ATSKVLRTMNIDRQPKETCSEIY---GWNMTFEQICAG--NTLSQLCSTDSG 225
            ..:.|.:.|.:  |...:||.:.:....|.||...|   .:.:|.|.:|||  ......|:.|||
  Fly   150 VVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSG 214

  Fly   226 APQIRKMWHNGSDRYVQLGIASRVKGQCQNS---GILMDLLSYADWIKRVVRQY 276
            .|    :..:|    |.:|:.|...| |...   |:...:.|:.|||:.....|
  Fly   215 GP----LAVDG----VLVGVVSWGVG-CGREGFPGVYTSVNSHIDWIEEQAEAY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/237 (25%)
Tryp_SPc 48..269 CDD:214473 58/234 (25%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 60/240 (25%)
Tryp_SPc 28..255 CDD:238113 62/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.