DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and thetaTry

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:263 Identity:65/263 - (24%)
Similarity:99/263 - (37%) Gaps:56/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GIPHNISERSVNAK---LAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLL--ITVRL 88
            |.|.....|.|..:   :..:|:...|:|..|.| |.|:|||...|:|||||:....:  :.|||
  Fly    26 GDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRL 90

  Fly    89 GE--YNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICI 151
            |.  ||....|.....|.      ||.|       ||:.....|:|:|:|..:|:...:||.|.:
  Fly    91 GSTLYNEGGIVVAVRELA------YNED-------YNSKTMEYDVGILKLDEKVKETENIRYIEL 142

  Fly   152 FASNRFQEPIDQLTWFTTTVWRETA---ANATSKVLRTMNIDRQPKETCSE---IYGWNMTFEQI 210
            ..     |.....|....|.|....   .....|.|:.:.::....:||:.   .||..:....:
  Fly   143 AT-----ETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMV 202

  Fly   211 CAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKG------QCQNS---GILMDLLSYA 266
            ||.......|..|||.|               |.:.:.:.|      .|.::   |:..|:.:..
  Fly   203 CAYEKKKDACQGDSGGP---------------LAVGNTLVGIVSWGYACASNLLPGVYSDVPALR 252

  Fly   267 DWI 269
            .||
  Fly   253 KWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 61/242 (25%)
Tryp_SPc 48..269 CDD:214473 59/240 (25%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 61/253 (24%)
Tryp_SPc 35..255 CDD:238113 60/252 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.