DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and PRSS41

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:311 Identity:81/311 - (26%)
Similarity:122/311 - (39%) Gaps:90/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEEDCGIPHNISERSVNAKLAQN--------PWMAYLETPKGFHCSGTLINHLFVLTAAHC--- 77
            ||.|.||      .|.::|.:|..        ||.|.|...:...|.|:|::..:||:||||   
Human    57 LLSEACG------HREIHALVAGGVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAHCFQK 115

  Fly    78 --VPDDLLITVRLGE------------YNTKTKVDCDNHLCQEPFQEYNVD---MGFRHRYYNAN 125
              .|.:.  ||:|||            |:::.||           |:..|:   :|...      
Human   116 HYYPSEW--TVQLGELTSRPTPWNLRAYSSRYKV-----------QDIIVNPDALGVLR------ 161

  Fly   126 DQTNDIGMLRLGRRVEYLNHIRPICIFASN-RFQEPIDQLTWFTTTVWRETAANATSKV----LR 185
               |||.:|||...|.|..:|:||||.:|. .|....|  .|  .|.|...:.:.|...    ||
Human   162 ---NDIALLRLASSVTYNAYIQPICIESSTFNFVHRPD--CW--VTGWGLISPSGTPLPPPYNLR 219

  Fly   186 TMNIDRQPKETCSEIYG--------WNMTFEQICAG--NTLSQLCSTDSGAPQI---RKMWHNGS 237
            ...:.......|:.::.        |:..|   |||  :.....|..|||.|.:   ..:|:   
Human   220 EAQVTILNNTRCNYLFEQPSSRSMIWDSMF---CAGAEDGSVDTCKGDSGGPLVCDKDGLWY--- 278

  Fly   238 DRYVQLGIAS--RVKGQCQNSGILMDLLSYADWIKRVVRQYGPSTDMNRSL 286
                |:||.|  ...||....|:..::..|..||:||:....|..:.::.|
Human   279 ----QVGIVSWGMDCGQPNRPGVYTNISVYFHWIRRVMSHSTPRPNPSQLL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 69/263 (26%)
Tryp_SPc 48..269 CDD:214473 67/260 (26%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.