DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG8170

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster


Alignment Length:280 Identity:78/280 - (27%)
Similarity:116/280 - (41%) Gaps:58/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EEDCGI--PHNISERSV----NAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCV----PD 80
            |..|||  ....::|.:    :|.....||.||:..... .|.|:||:...|:||.|||    |.
  Fly   596 EPSCGISLAKQTAQRRIVGGDDAGFGSFPWQAYIRIGSS-RCGGSLISRRHVVTAGHCVARATPR 659

  Fly    81 DLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFR----HRYYNANDQTN--DIGMLRLGRR 139
            .:.:|  ||:|...:.|        ||...|.  .|.|    |.|:....|.:  ||.:|.|.|.
  Fly   660 QVHVT--LGDYVINSAV--------EPLPAYT--FGVRRIDVHPYFKFTPQADRFDISVLTLERT 712

  Fly   140 VEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATS----KVLRTMNIDRQPKETCSEI 200
            |.::.||.|||:...|  ::.:.:..|  ...|  .|.|..|    |.|:.:::.......|...
  Fly   713 VHFMPHIAPICLPEKN--EDFLGKFGW--AAGW--GALNPGSRLRPKTLQAVDVPVIENRICERW 771

  Fly   201 Y---GWNMTF--EQICAG--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIAS-----RVKGQC 253
            :   |.|:..  |.:|||  |.....|..|||.|    :.|:.:.|:..:|:.|     ..:|| 
  Fly   772 HRQNGINVVIYQEMLCAGYRNGGKDSCQGDSGGP----LMHDKNGRWYLIGVVSAGYSCASRGQ- 831

  Fly   254 QNSGILMDLLSYADWIKRVV 273
              .||...:....||:..||
  Fly   832 --PGIYHSVSKTVDWVSYVV 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 70/249 (28%)
Tryp_SPc 48..269 CDD:214473 69/246 (28%)
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 70/259 (27%)
Tryp_SPc 612..846 CDD:238113 71/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.