DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG8172

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:284 Identity:77/284 - (27%)
Similarity:121/284 - (42%) Gaps:52/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WRRVQGFQMLLEEDCGIPHNISERSV---NAKLAQNPWMAYLETPKGF-----HCSGTLINHLFV 71
            :|.|.|        ||..:..|.|.|   :.....:||...| ...||     .|.|.||::.:|
  Fly   300 YRPVPG--------CGEVYTRSNRIVGGHSTGFGSHPWQVAL-IKSGFLTRKLSCGGALISNRWV 355

  Fly    72 LTAAHCV---PDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGM 133
            :||||||   |:..: .:||||::.:.:.:..||      :||.::....|.:||..|..||:.:
  Fly   356 ITAAHCVASTPNSNM-KIRLGEWDVRGQEERLNH------EEYGIERKEVHPHYNPADFVNDVAL 413

  Fly   134 LRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTV--WRET--AANATSKVLRTMNIDRQPK 194
            :||.|.|.|..||.|:|:..|.      .:||....||  |..|  ..:....||:.::::....
  Fly   414 IRLDRNVVYKQHIIPVCLPPST------TKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISN 472

  Fly   195 ETCSEIY---GWNMTFEQI--CAG--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQ 252
            :.|...:   |.......:  |||  :.....|..|||.|....|    ..|...:|:.|...| 
  Fly   473 DRCQRWFRAAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTM----DGRKTLIGLVSWGIG- 532

  Fly   253 CQNS---GILMDLLSYADWIKRVV 273
            |...   |:..::..:..||.:|:
  Fly   533 CGREHLPGVYTNIQRFVPWINKVM 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 68/245 (28%)
Tryp_SPc 48..269 CDD:214473 66/242 (27%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 68/255 (27%)
Tryp_SPc 316..555 CDD:238113 69/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.