DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Np

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:274 Identity:71/274 - (25%)
Similarity:107/274 - (39%) Gaps:43/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EEDCG---IPHNISERSVNAKLAQNPWMAYL---ETPKGFH-CSGTLINHLFVLTAAHCV----P 79
            :|.||   .|........||...:.||...|   .|....| |...|:|..:.:||||||    |
  Fly   785 KEVCGRRMFPEPRIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPP 849

  Fly    80 DDLLITVRLGEYNTKTKVDCDNHLCQEP--FQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEY 142
            .|||:  |||||:...:        :||  :||..|.:...|..::......|:.:||....|.:
  Fly   850 SDLLL--RLGEYDLAEE--------EEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIF 904

  Fly   143 LNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTF 207
            ..:|.|:|:  .:..:..|.| |.|.|...|.........||:.:.:.......|..:|......
  Fly   905 QPNIIPVCV--PDNDENFIGQ-TAFVTGWGRLYEDGPLPSVLQEVAVPVINNTICESMYRSAGYI 966

  Fly   208 EQ-----ICAGNTLS--QLCSTDSGAPQI-----RKMWHNGSDRYVQLGIASRVKGQCQNSGILM 260
            |.     ||||....  ..|..|||.|.:     .|.:|.|.  .:..||..   .:....|:..
  Fly   967 EHIPHIFICAGWKKGGYDSCEGDSGGPMVLQRESDKRFHLGG--VISWGIGC---AEANQPGVYT 1026

  Fly   261 DLLSYADWIKRVVR 274
            .:..:.|||.::::
  Fly  1027 RISEFRDWINQILQ 1040

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 65/245 (27%)
Tryp_SPc 48..269 CDD:214473 63/242 (26%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 65/255 (25%)
Tryp_SPc 798..1038 CDD:238113 67/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.