DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Jon44E

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:226 Identity:58/226 - (25%)
Similarity:93/226 - (41%) Gaps:38/226 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYY 122
            |:.|.|::|:|.:|||||||......:.:..|.        ...|..|........|| .:|..:
  Fly    64 GYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGA--------SFRHEAQYTHWVSRSDM-IQHPDW 119

  Fly   123 NANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLT-----WFTTTVWRETAANA-TS 181
            | :...|||.::|: ..|::.:.:..:.:.:.|      |:..     |...:.|..|..|: .|
  Fly   120 N-DFLNNDIALIRI-PHVDFWSLVNKVELPSYN------DRYNSYSGWWAVASGWGLTDNNSGMS 176

  Fly   182 KVLRTMNIDRQPKETCSEIYGWN-MTFEQICA---GNTLSQLCSTDSGAPQIRKMWHNGSDRYVQ 242
            ..|..:::.......|...||.| :|...||.   |...|  ||.|||.|.:.    :.::|.| 
  Fly   177 NYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSS--CSGDSGGPLVL----HDNNRIV- 234

  Fly   243 LGIASRVKGQCQNSGI---LMDLLSYADWIK 270
             ||.|...|:...:|.   ...:..|.|||:
  Fly   235 -GIVSFGSGEGCTAGRPAGFTRVTGYLDWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 58/226 (26%)
Tryp_SPc 48..269 CDD:214473 56/223 (25%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 56/223 (25%)
Tryp_SPc 41..266 CDD:238113 58/226 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.