Sequence 1: | NP_995844.2 | Gene: | CG33462 / 2768841 | FlyBaseID: | FBgn0053462 | Length: | 300 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001021891.1 | Gene: | try-9 / 3565941 | WormBaseID: | WBGene00023425 | Length: | 279 | Species: | Caenorhabditis elegans |
Alignment Length: | 306 | Identity: | 57/306 - (18%) |
---|---|---|---|
Similarity: | 103/306 - (33%) | Gaps: | 119/306 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 SERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHC--VPDDLLITVRLGEYNTKTKVD 98
Fly 99 CDNHLCQEPF--QEYNVDMGF-------------RHR------------YYNA---------NDQ 127
Fly 128 TNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQ 192
Fly 193 PKET----------------CSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYV 241
Fly 242 Q--LGIAS-------------RVKGQ----CQNSGILMDLLSYADW 268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33462 | NP_995844.2 | Tryp_SPc | 48..272 | CDD:238113 | 53/294 (18%) |
Tryp_SPc | 48..269 | CDD:214473 | 53/294 (18%) | ||
try-9 | NP_001021891.1 | Tryp_SPc | 30..237 | CDD:389826 | 46/244 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |