DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and try-9

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:306 Identity:57/306 - (18%)
Similarity:103/306 - (33%) Gaps:119/306 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHC--VPDDLLITVRLGEYNTKTKVD 98
            |.|:...|.::|.::.        |.:|||::...::||||.  :.:|.|             .|
 Worm    11 SFRNGGNKFSENEFVQ--------HGTGTLVSPWHIVTAAHLIGISEDPL-------------PD 54

  Fly    99 CDNHLCQEPF--QEYNVDMGF-------------RHR------------YYNA---------NDQ 127
            ||....:|.:  ::|...:.|             .||            |...         .:.
 Worm    55 CDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRES 119

  Fly   128 TNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQ 192
            .|||.:..|...:|:...|.|.|:.::.:    |.::        |||.       .:.....|.
 Worm   120 FNDIAVFELEEPIEFSKDIFPACLPSAPK----IPRI--------RETG-------YKLFGYGRD 165

  Fly   193 PKET----------------CSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYV 241
            |.::                ||:.:.:...:........||  |..|||:..:|    ....|.|
 Worm   166 PSDSVLESGKLKSLYSFVAECSDDFPYGGVYCTSAVNRGLS--CDGDSGSGVVR----TSDTRNV 224

  Fly   242 Q--LGIAS-------------RVKGQ----CQNSGILMDLLSYADW 268
            |  :|:.|             |.:.|    .|.:.:|:|:.::.|:
 Worm   225 QVLVGVLSAGMPCPELYDTHNRQRQQRRQLTQETDLLVDVSAHVDF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 53/294 (18%)
Tryp_SPc 48..269 CDD:214473 53/294 (18%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 46/244 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.