DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and scaf

DIOPT Version :10

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:202 Identity:57/202 - (28%)
Similarity:93/202 - (46%) Gaps:38/202 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RSVNAKLAQNPWMAYL--ETPKGFHCSGTLINHLFVLTAAHCVPDDLLIT---VRLGEY---NTK 94
            :.::|..|:.||.|.:  |:.|...|.|.:|...|||::|.|| :.|.:|   |:.||:   :|.
  Fly   425 KDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCV-NGLPVTDIRVKAGEWELGSTN 488

  Fly    95 TKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQE 159
            ..:         |||...|.....|..|:.:..::|:.::||.||:|:.:||:||||    ..::
  Fly   489 EPL---------PFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICI----SDED 540

  Fly   160 PIDQLTWFTTTVWRETAAN-----ATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQL 219
            |.|....||:. |.:.|.:     |...|..|:   .|.:..||      .....:|:. |....
  Fly   541 PKDSEQCFTSG-WGKQALSIHEEGALMHVTDTL---PQARSECS------ADSSSVCSA-TKFDS 594

  Fly   220 CSTDSGA 226
            |..|.|:
  Fly   595 CQFDVGS 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 55/192 (29%)
scafNP_610180.1 Atrophin-1 <63..>338 CDD:460830
CLIP_SPH_Scar 343..408 CDD:465747
Tryp_SPc 428..616 CDD:238113 57/199 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.