DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and scaf

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:202 Identity:57/202 - (28%)
Similarity:93/202 - (46%) Gaps:38/202 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RSVNAKLAQNPWMAYL--ETPKGFHCSGTLINHLFVLTAAHCVPDDLLIT---VRLGEY---NTK 94
            :.::|..|:.||.|.:  |:.|...|.|.:|...|||::|.|| :.|.:|   |:.||:   :|.
  Fly   425 KDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCV-NGLPVTDIRVKAGEWELGSTN 488

  Fly    95 TKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQE 159
            ..:         |||...|.....|..|:.:..::|:.::||.||:|:.:||:||||    ..::
  Fly   489 EPL---------PFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICI----SDED 540

  Fly   160 PIDQLTWFTTTVWRETAAN-----ATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQL 219
            |.|....||:. |.:.|.:     |...|..|:   .|.:..||      .....:|:. |....
  Fly   541 PKDSEQCFTSG-WGKQALSIHEEGALMHVTDTL---PQARSECS------ADSSSVCSA-TKFDS 594

  Fly   220 CSTDSGA 226
            |..|.|:
  Fly   595 CQFDVGS 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 55/192 (29%)
Tryp_SPc 48..269 CDD:214473 55/192 (29%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 57/199 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435508
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.