DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG17571

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:260 Identity:60/260 - (23%)
Similarity:99/260 - (38%) Gaps:66/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RSVNAK---LAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCV----PDDL------------ 82
            |.||.:   :...|:...::|.||.| |.|:||:...|||||||:    ..:|            
  Fly    30 RIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSRSSG 94

  Fly    83 --LITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNH 145
              ::|||..:|                           |..||:....||:.:::|...|...:.
  Fly    95 GEVVTVRAFKY---------------------------HEGYNSKLMINDVAIIKLSSPVRQTSK 132

  Fly   146 IRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSE---IYGWNMTF 207
            ||.|.:..|.........::.:.||.:...::..|   |:.:.:|....:.|:.   .||.:...
  Fly   133 IRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDT---LQKVEVDLLHYKDCAADTYNYGSDSIL 194

  Fly   208 E-QICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS--GILMDLLSYADWI 269
            | .:||.......|..|||.|.:       :|..: :|:.|...|.....  |:..|:.|...||
  Fly   195 ETMVCATGEKKDACQGDSGGPLV-------ADNKL-VGVVSWGSGCAWTGYPGVYADVASLRSWI 251

  Fly   270  269
              Fly   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 57/247 (23%)
Tryp_SPc 48..269 CDD:214473 55/245 (22%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 58/258 (22%)
Tryp_SPc 31..254 CDD:238113 59/259 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.