DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Prss21

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:286 Identity:70/286 - (24%)
Similarity:114/286 - (39%) Gaps:50/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEEDCG---IPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVP---DDL 82
            ||...||   ||..| .....|:|.:.||...|.......|..||:|..:|||||||..   |..
  Rat    44 LLSGPCGHRTIPSRI-VGGEEAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAAHCFQKDNDPF 107

  Fly    83 LITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIR 147
            ..||:.||..::..:    ...|.....|.::..|....| .....:||.:|:|...|.|.|.|:
  Rat   108 DWTVQFGELTSRPSL----WNLQAYSNRYQIEDIFLSPKY-TEQFPHDIALLKLSSPVTYSNFIQ 167

  Fly   148 PICIFASN-RFQEPIDQLTWFTTTVWRETAANATSKV---LRTMNIDRQPKETCSEI-----YGW 203
            |||:..|. :|....|  .|  .|.|.....:.:..:   |:.:.:.......|:.:     :..
  Rat   168 PICLLNSTYKFANRTD--CW--VTGWGAIGEDESLPLPNNLQEVQVAIINNTMCNHLFKKPDFRI 228

  Fly   204 NMTFEQICAGN-------TLSQLC----STDSGAPQI---RKMWHNGSDRYVQLGIASRVKGQC- 253
            |:..:.:|||:       ..::|.    ..|||.|.:   ..:|:       |:|:.|...| | 
  Rat   229 NIWGDMVCAGSPEGGKDACFAKLTYAAPQGDSGGPLVCNQDTVWY-------QVGVVSWGIG-CG 285

  Fly   254 --QNSGILMDLLSYADWIKRVVRQYG 277
              ...|:..::..:.:||:..:.:.|
  Rat   286 RPNRPGVYTNISHHYNWIRLTMIRNG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/252 (24%)
Tryp_SPc 48..269 CDD:214473 58/249 (23%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 61/263 (23%)
Tryp_SPc 58..304 CDD:238113 62/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.