DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG4793

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:332 Identity:76/332 - (22%)
Similarity:125/332 - (37%) Gaps:89/332 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CC-----LWRRVQGFQMLLEEDCGIPHNI-------SERSVNAKLAQNPWMAYL-----ETPKGF 59
            ||     |...||.....|..:||..:.|       :.|.: |:..:.|||..|     ..|.| 
  Fly    64 CCPKTEILQYPVQADNQPLPTECGHVNRIGVGFTITNARDI-AQKGELPWMVALLDSRSRLPLG- 126

  Fly    60 HCSGTLINHLFVLTAAHC---VPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRY 121
              .|:||....|||::..   ||:..|| ||.||::.::..:      :...::..:....||..
  Fly   127 --GGSLITRDVVLTSSTKTLEVPEKYLI-VRAGEWDFESITE------ERAHEDVAIRKIVRHTN 182

  Fly   122 YNANDQTNDIGMLRLGRRVEYLNHIRPICI------FASNRFQEPIDQLTWFTTTVWRETAA--N 178
            .:..:..|:..:|.|.|.::..:||..||:      |..||          ...:.|.:..|  |
  Fly   183 LSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNR----------CIVSGWGKKTALDN 237

  Fly   179 ATSKVLRTMNIDRQPKETCSE----IYGWNMTFEQ--ICAGNTLSQ-LCSTDSGAPQIRKMWHNG 236
            :...:|:.:.:....:..|..    .||.:...:.  ||||....: .|..|.|||....: .:.
  Fly   238 SYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPL-QSD 301

  Fly   237 SDRYVQLGIASRVKGQCQNSGILMDLLSYADWIKRVVRQYGP----STDMNRSLKKWVDKI---- 293
            .:||..|||.:...| |.                      ||    .||::: ::.|:|..    
  Fly   302 PNRYELLGIVNFGFG-CG----------------------GPLPAAYTDVSQ-IRSWIDNCIQAE 342

  Fly   294 PVFYYPK 300
            .|.|.|:
  Fly   343 AVHYSPQ 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 56/246 (23%)
Tryp_SPc 48..269 CDD:214473 56/243 (23%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 62/276 (22%)
Tryp_SPc 105..335 CDD:214473 61/274 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.