DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG18477

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:347 Identity:70/347 - (20%)
Similarity:116/347 - (33%) Gaps:111/347 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EEDCGIPHNISERSVNAKLAQNPWMAYL--ETPKGFHCSGTLINHLFVLTAAHCVPDDLL--ITV 86
            |||.|:          |:.|:.|||..|  .....:...|.||....|:||.....:...  :.|
  Fly   107 EEDTGL----------AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVV 161

  Fly    87 RLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICI 151
            |.||::..||.:      |.|..:..:....||..:|..:..|::.::.|.|.:....||.|||:
  Fly   162 RAGEWDFSTKTE------QLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICM 220

  Fly   152 ----------------FASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSE- 199
                            :..|.|.:|                  :...||:.:::....:.||.: 
  Fly   221 PSAPKNFDFSRCIFTGWGKNSFDDP------------------SYMNVLKKISLPVVQRRTCEQQ 267

  Fly   200 ---IYGWNMTFEQ--ICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRY-----VQLGIASRVKGQC 253
               .||.:...:.  :|||....: .|..|.|:|....:..| ..||     |..|:...:.|. 
  Fly   268 LRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDN-PQRYELAGIVNFGVDCGLPGV- 330

  Fly   254 QNSGILMDLLSYADWI------------KRVVRQYGPSTDMNRSLKKW--------------VDK 292
              ..:..::.:..:||            :..|....|:......|.:|              |:.
  Fly   331 --PAVYTNVANVIEWITLTTVNMPLPEEREEVPYASPTLSAGPYLNQWNQPNYEWLPTGYPNVNS 393

  Fly   293 IP---------------VFYYP 299
            ||               |.|||
  Fly   394 IPWQLQEANNDLANSQYVRYYP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 53/267 (20%)
Tryp_SPc 48..269 CDD:214473 51/252 (20%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 53/258 (21%)
Tryp_SPc 113..344 CDD:238113 53/258 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.