DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG9377

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:274 Identity:57/274 - (20%)
Similarity:108/274 - (39%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHN-------ISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITV 86
            ||..|:       :..:...||..:.||:..:.....:.|||.||..|.|:|.||||.:..:..|
  Fly    87 CGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKV 151

  Fly    87 RL--GEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRR--VEYLNHIR 147
            ||  ||::...:::      .:|.|:.:|.....|..|......::|.:|.:.:.  .:...:::
  Fly   152 RLLAGEWDAAVELE------PQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQ 210

  Fly   148 PICIFASNRFQEPIDQLTW----FTTTVWRETAANATSKVLRTMNIDRQPKETCS-----EIYGW 203
            |||:        |..::.:    ...:.|:.:.....:.:.:...:...|.:.|.     .:.|.
  Fly   211 PICL--------PPPRIMYNYSQCYVSGWQRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGR 267

  Fly   204 NMTFEQ--ICAGNTLSQ-LC-STDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC---QNSGILMD 261
            ......  :|||..... :| ..|..|..:........||:...|:.:|. .:|   |..||..:
  Fly   268 RHAHNDSLLCAGGDKGDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTRT-ARCDGPQLLGIYTN 331

  Fly   262 LLSYADWIKRVVRQ 275
            :..|..||...:|:
  Fly   332 VKLYRQWIDLKLRE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 51/243 (21%)
Tryp_SPc 48..269 CDD:214473 49/240 (20%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 52/249 (21%)
Tryp_SPc 105..339 CDD:214473 51/248 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435475
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.