DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG9377

DIOPT Version :10

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:274 Identity:57/274 - (20%)
Similarity:108/274 - (39%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHN-------ISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITV 86
            ||..|:       :..:...||..:.||:..:.....:.|||.||..|.|:|.||||.:..:..|
  Fly    87 CGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKV 151

  Fly    87 RL--GEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRR--VEYLNHIR 147
            ||  ||::...:::      .:|.|:.:|.....|..|......::|.:|.:.:.  .:...:::
  Fly   152 RLLAGEWDAAVELE------PQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQ 210

  Fly   148 PICIFASNRFQEPIDQLTW----FTTTVWRETAANATSKVLRTMNIDRQPKETCS-----EIYGW 203
            |||:        |..::.:    ...:.|:.:.....:.:.:...:...|.:.|.     .:.|.
  Fly   211 PICL--------PPPRIMYNYSQCYVSGWQRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGR 267

  Fly   204 NMTFEQ--ICAGNTLSQ-LC-STDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC---QNSGILMD 261
            ......  :|||..... :| ..|..|..:........||:...|:.:|. .:|   |..||..:
  Fly   268 RHAHNDSLLCAGGDKGDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTRT-ARCDGPQLLGIYTN 331

  Fly   262 LLSYADWIKRVVRQ 275
            :..|..||...:|:
  Fly   332 VKLYRQWIDLKLRE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 51/243 (21%)
CG9377NP_609640.1 PRK06406 <19..>80 CDD:235796
Tryp_SPc 105..339 CDD:214473 51/248 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.