DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:217 Identity:53/217 - (24%)
Similarity:89/217 - (41%) Gaps:23/217 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYY 122
            |:.|.|::|.|.:|||||||......:|:..|. ..:|.....:.:....|.:       .|.:.
  Fly    61 GWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGA-TWRTNAQFTHTVGSGDFIQ-------NHNWP 117

  Fly   123 NANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTM 187
            |.|.  |||.::|. ..|::.:.:..:.:.:.|......|.. |.....|..|.|.:....:..:
  Fly   118 NQNG--NDIALIRT-PHVDFWHMVNKVELPSFNDRYNMYDNY-WAVACGWGLTTAGSQPDWMECV 178

  Fly   188 NIDRQPKETCSEIYGWNMTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKG 251
            ::.......||..|| ......:|...:..: .||.|||.|.:   .|:|. |.|  |:.|.|.|
  Fly   179 DLQIISNSECSRTYG-TQPDGILCVSTSGGKSTCSGDSGGPLV---LHDGG-RLV--GVTSWVSG 236

  Fly   252 QCQNSGI---LMDLLSYADWIK 270
            ....:|:   ...:.:..|||:
  Fly   237 NGCTAGLPSGFTRVTNQLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 53/217 (24%)
Tryp_SPc 48..269 CDD:214473 51/214 (24%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 51/214 (24%)
Tryp_SPc 37..260 CDD:238113 53/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.