DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG3355

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:264 Identity:74/264 - (28%)
Similarity:110/264 - (41%) Gaps:48/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISERSVNAKLAQN--PWMAYLETPKGFH-----CSGTLINHLFVLTAAHCVPDDL-LIT 85
            ||.| |::......::..|  ||.|.|  .||.|     |.|:|||..:||||||||..:. .||
  Fly    68 CGTP-NVNRIVGGQQVRSNKYPWTAQL--VKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQIT 129

  Fly    86 VRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPIC 150
            :||.:.:..::         :|.....|.....|..|:.|...||:.:|:|...|....::||:|
  Fly   130 IRLLQIDRSSR---------DPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVC 185

  Fly   151 IFASNRFQEPIDQLTWFTTTV--W---RETAANATSKVLRTMNIDRQPKETCSEI-YGWNMTFEQ 209
            :..:|.      .....|..|  |   :|  ...||..|:.:|:.......|.:. |...:....
  Fly   186 LPEANH------NFDGKTAVVAGWGLIKE--GGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVM 242

  Fly   210 ICAGNTLSQ-----LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS--GILMDLLSYAD 267
            :|||  |.|     .|..|||.|.|     ....||...|:.|...|..|.:  |:...:..:.|
  Fly   243 LCAG--LVQQGGKDACQGDSGGPLI-----VNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLD 300

  Fly   268 WIKR 271
            ||::
  Fly   301 WIRK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 69/243 (28%)
Tryp_SPc 48..269 CDD:214473 67/239 (28%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 68/252 (27%)
Tryp_SPc 76..305 CDD:238113 70/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.