DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG31954

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:292 Identity:63/292 - (21%)
Similarity:102/292 - (34%) Gaps:78/292 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 MLLEEDCGIPHNISERSVNAKLAQNPWMAYLETPK------GFH-------------------CS 62
            ::|...|.||..:..:.....:.:|||..   :|:      |.|                   |.
  Fly    15 LVLAGVCLIPQPVKRQRSLEDVIKNPWKL---SPRLDGRIVGGHRINITDAPHQVSLQTSSHICG 76

  Fly    63 GTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQ 127
            |::|:..::||||||.         .|:...:.||...........|...|....:|..:|..:.
  Fly    77 GSIISEEWILTAAHCT---------YGKTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNV 132

  Fly   128 TNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFT-----TTVWRETAANATSKV-LRT 186
            ..|..:|:|...:::....:.:.:        |..|:.:..     .:.|..|.....|:. ||.
  Fly   133 DYDFSLLQLAHPIKFDETKKAVKL--------PESQMKYMDGEACFVSGWGNTQNLLESREWLRQ 189

  Fly   187 MNIDRQPKETCSEIYG--WNMTFEQICAG--NTLSQLCSTDSGAPQIRK--------MWHNGSDR 239
            :.:....:|.|||.|.  ..:|...||||  ......|..|||.|.:.:        .|..|..:
  Fly   190 VEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAK 254

  Fly   240 YVQLGIASRVKGQCQNSGILMDLLSYA-DWIK 270
            ....|:.|||              |:| ||||
  Fly   255 PDYPGVYSRV--------------SFARDWIK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 58/267 (22%)
Tryp_SPc 48..269 CDD:214473 55/264 (21%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 52/251 (21%)
Tryp_SPc 51..274 CDD:238113 55/253 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.