DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Ser6

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:272 Identity:60/272 - (22%)
Similarity:102/272 - (37%) Gaps:92/272 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PHNISERSVNAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLL-----------I 84
            ||.:|.|:.                 |.| |.|:::...::|||||||.::.:           .
  Fly    44 PHQVSLRNA-----------------GSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERF 91

  Fly    85 TVRLG---EYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHI 146
            |:|.|   .::....|.....:..|.:..:                .||:.:|||.         
  Fly    92 TIRAGSNDRFSGGVLVQVAEVIVHEEYGNF----------------LNDVALLRLE--------- 131

  Fly   147 RPICIFASNRFQEPIDQLTWFT-------TTVW-RETAANATSKVLRTMNIDRQPKETCSEIYGW 203
            .|:.:.||   .:|||..|..|       .:.| |........:.|:...:....::.|.|:..:
  Fly   132 SPLILSAS---IQPIDLPTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELIDF 193

  Fly   204 NMTFE-QICAGNTLSQL----CSTDSGAPQIRKMWHNGSDRYVQL-GIASRVKGQCQNS---GIL 259
            .  || ::|   .|.|:    |:.|||.|.:   ::|      || |:|..|...|.::   |..
  Fly   194 G--FEGELC---LLHQVDNGACNGDSGGPAV---YNN------QLVGVAGFVVDGCGSTYPDGYA 244

  Fly   260 MDLLSYADWIKR 271
            . :..:.||||:
  Fly   245 R-VFYFKDWIKK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 56/256 (22%)
Tryp_SPc 48..269 CDD:214473 53/252 (21%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 57/268 (21%)
Tryp_SPc 32..256 CDD:238113 60/272 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.