DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG14227

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:275 Identity:85/275 - (30%)
Similarity:120/275 - (43%) Gaps:42/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QGFQMLLEEDCGIPHNISERSV--NAKLA------------QNPWMAYLETPKGFHCSGTLINHL 69
            :|...||:.:||       ||:  ||||.            .|||:..:.......|||:||||.
  Fly    21 EGSAFLLDAECG-------RSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVNGKAKCSGSLINHR 78

  Fly    70 FVLTAAHCVPDDLLITVRLGEY-------NTKTKVDCDNHLCQEPFQEYNVDMGFRHR-YYNAND 126
            |||||||||..:.: .|.||::       |..:.....|..|      ..:|....|. :.....
  Fly    79 FVLTAAHCVFREAM-QVHLGDFDAWNPGQNCSSGARLSNAYC------VRIDKKIVHAGFGKIQA 136

  Fly   127 QTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATS--KVLRTMNI 189
            |..|||:||:...|:|.:.:||||:.    ..||:..:..|..|||..||.:..|  :||:....
  Fly   137 QQYDIGLLRMQHAVQYSDFVRPICLL----INEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVG 197

  Fly   190 DRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQ 254
            ||..:|.|:..:...:...|||.....|..|..|||.|...|:.:.|:.|..|.||.......|.
  Fly   198 DRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCA 262

  Fly   255 NSGILMDLLSYADWI 269
            ...:..::..|.|||
  Fly   263 GLSVCTNVTFYMDWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 73/232 (31%)
Tryp_SPc 48..269 CDD:214473 71/230 (31%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 71/230 (31%)
Tryp_SPc 57..277 CDD:238113 71/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.