DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG15046

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_573298.1 Gene:CG15046 / 32833 FlyBaseID:FBgn0030927 Length:494 Species:Drosophila melanogaster


Alignment Length:301 Identity:55/301 - (18%)
Similarity:99/301 - (32%) Gaps:96/301 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VICC-----LWRRVQ-GFQMLLEEDCGIPHNISERSVNAKLAQNP-----------------WMA 51
            :|||     |..||. |.::.::.|          |...|.|::|                 .:|
  Fly   211 IICCPLNLPLQPRVHTGLRLGVQGD----------SSEGKAAEDPLELAAIARADRLLPHYRHLA 265

  Fly    52 YLETPKG------FHCSGTLINHLFVLTAAHCV-PDDLLITVRLGEYNTKTKVDCDNHLCQEPFQ 109
            .|..|..      .||:..::....:::||.|. |...:..|.     ....||.|        :
  Fly   266 SLAHPNAAFDGHLHHCAALVLTPQLLVSAAGCERPSHAVFGVA-----DLRDVDAD--------E 317

  Fly   110 EYNVDMGFRHRYYNANDQTNDIGM------LRLGRRVEYLNHIRPICI-FASNRFQE--PIDQLT 165
            :|..|:....::      ..|:.:      ||||.:......:.|||. |...|.|.  .:..:.
  Fly   318 DYLADIVRLVQF------QKDLSLIRLQDPLRLGSQTSANVSVAPICTQFELTRLQRSGSLVAVG 376

  Fly   166 WFTTTVWRETAANATSKVLRTMNIDRQPKETCSEI--YG--WNMTFEQIC-------------AG 213
            |        .....|...|..|.:..:|...|.::  ||  .::....:|             :.
  Fly   377 W--------GKGEDTDCPLFEMPMRLRPTWACGDLPNYGGVQDLGSSHLCVEPMDGERELQRFSN 433

  Fly   214 NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQ 254
            ::....|....|:  :..:...|..|.| :|:|:....:|:
  Fly   434 SSTCAACPASVGS--VLHLVRPGGGRCV-IGVATPTGAECE 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 44/257 (17%)
Tryp_SPc 48..269 CDD:214473 44/257 (17%)
CG15046NP_573298.1 CLIP 35..82 CDD:197829
CLIP 168..215 CDD:197829 2/3 (67%)
Tryp_SPc 274..>379 CDD:304450 24/131 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.