DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Hayan

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:272 Identity:78/272 - (28%)
Similarity:114/272 - (41%) Gaps:58/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCGI-PHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCV--PDDLLITVRLG 89
            |.|: ||       .|.:|.|.:.:     ..|.|.|:||...|||||||||  .|.....||||
  Fly   392 DRGVYPH-------MAAIAYNSFGS-----AAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLG 444

  Fly    90 EYNTKTKVDCDNHLCQEP-FQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFA 153
            ..|.:.         .|| :|:.||.....|..|:.:.:..||.:|:|....:..:.|||.|::.
  Fly   445 ALNIEN---------PEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYT 500

  Fly   154 SNRFQEPIDQLTWFTTTVW--RETAANATSKVLRTMNIDRQPKETCSEIYGWNMTF-EQICAGNT 215
            ..  .:|.....:|... |  ......|.||:|....:|..|.:.|      |.:| ||..|..|
  Fly   501 DR--SDPPANYKYFVAG-WGVMNVTNRAVSKILLRAALDLVPADEC------NASFAEQPSANRT 556

  Fly   216 L------SQLCST-----------DSGAPQIRKMWHNGSDRYVQLGIASRVKGQC--QNSGILMD 261
            |      ||||:.           |||.|.|.:: .:....|..:|:.|...| |  :..|:...
  Fly   557 LRRGVIASQLCAADKNQRKDACQGDSGGPLILEI-DDVDGTYSIVGVISSGFG-CATKTPGLYTR 619

  Fly   262 LLSYADWIKRVV 273
            :.|:.|:|:.:|
  Fly   620 VSSFLDYIEGIV 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 70/248 (28%)
Tryp_SPc 48..269 CDD:214473 69/245 (28%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 76/266 (29%)
Tryp_SPc 385..630 CDD:238113 77/269 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.