DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and sphe

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:292 Identity:64/292 - (21%)
Similarity:108/292 - (36%) Gaps:77/292 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IIGIAVI--CCLWRRVQGFQMLLEEDCGIPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLIN 67
            :||:..:  |....|:.|.:                  :|......:.|.|.......|.|::::
  Fly    11 LIGLTAVGMCHAQGRIMGGE------------------DADATATTFTASLRVDNAHVCGGSILS 57

  Fly    68 HLFVLTAAHCVPDD--LL----ITVRLGEYNTKTKVDCDNHLCQEPFQEY------NVDMGFRH- 119
            ...:||.||||..|  |:    :..|:|..|                 :|      ||:....| 
  Fly    58 QTKILTTAHCVHRDGKLIDASRLACRVGSTN-----------------QYAGGKIVNVESVAVHP 105

  Fly   120 RYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRF-----QEPIDQLTWFTTTVWRETAANA 179
            .|||.|   |::.::.|...:.|.:.|..|.:.||...     .|.|       ...|..|:...
  Fly   106 DYYNLN---NNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVI-------VAGWGRTSDGT 160

  Fly   180 TSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQL 243
            .|..:|.:::...|:.||.:.|. :...:..|..:.|.: .|..|.|...|   :.|     ..:
  Fly   161 NSYKIRQISLKVAPEATCLDAYS-DHDEQSFCLAHELKEGTCHGDGGGGAI---YGN-----TLI 216

  Fly   244 GIASRVKGQC--QNSGILMDLLSYADWIKRVV 273
            |:.:.|.|.|  :...:.:.|.||||||:..:
  Fly   217 GLTNFVVGACGSRYPDVFVRLSSYADWIQEQI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 58/244 (24%)
Tryp_SPc 48..269 CDD:214473 56/241 (23%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 57/240 (24%)
Tryp_SPc 42..244 CDD:214473 55/237 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.