DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG9676

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:278 Identity:57/278 - (20%)
Similarity:97/278 - (34%) Gaps:91/278 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PHNISERSVNAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKT 95
            ||.||.|.                 :|.| |.|::|:..:|:||||||..               
  Fly    40 PHQISLRR-----------------RGSHTCGGSIISKDYVVTAAHCVKQ--------------- 72

  Fly    96 KVDCDNHLCQEPFQEYNVDMGFR----------------HRYYNANDQTNDIGMLRLGRRVEYLN 144
                .|::.  |..|..:..|..                |..||:|.  :|:.:|||...:.:.:
  Fly    73 ----GNNVA--PANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNG--HDVAVLRLRNSLTFNS 129

  Fly   145 HIRPICIFASNRFQEPIDQLTWFTTTVWRETAANA-TSKVLRTMNIDRQPKETCSEIYGWNMTFE 208
            :|..|.:..    ::|.:..| ...:.|...:... .|..|..:.:....:|:|.:.|...:...
  Fly   130 NIAAIKLAT----EDPPNDAT-VDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPET 189

  Fly   209 QICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWIKRV 272
            .:|..:...: .|..|||.|..    :.|.    .:|:||.|.|.|..:.        .|..:||
  Fly   190 TMCLLHPKDKGACYGDSGGPAT----YQGK----LVGLASFVIGGCGRAA--------PDGYERV 238

  Fly   273 VRQYGPSTDMNRSLKKWV 290
            .:           |:.|:
  Fly   239 SK-----------LRNWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 48/242 (20%)
Tryp_SPc 48..269 CDD:214473 48/239 (20%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 56/276 (20%)
Tryp_SPc 28..248 CDD:238113 57/278 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.