DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG31220

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:277 Identity:84/277 - (30%)
Similarity:116/277 - (41%) Gaps:38/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCGIPHNISE--RSVNAKLAQNPWMAYL--ETPKGFH--------CSGTLINHLFVLTAAHCVPD 80
            |||.|...:.  ......|.:.||:|.|  .....|:        |.|:|||..:||||||||.|
  Fly    94 DCGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTD 158

  Fly    81 DLL--ITVRLGEYNTKTKVDCDNH----LCQEPFQEYNVDMGFRHRYYNANDQT--NDIGMLRLG 137
            .:|  ..|||||:.|....||.:.    :|.....:.:|:....|..|:..:.|  |||.::||.
  Fly   159 TVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLK 223

  Fly   138 RRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTV--WRETAANAT-SKVLRTMNIDRQPKETCSE 199
            ..|.|.....|||:....|      .|..|...|  |.:|....| ||||:...:..:..|.|||
  Fly   224 EPVRYTMAYYPICVLDYPR------SLMKFKMYVAGWGKTGMFDTGSKVLKHAAVKVRKPEECSE 282

  Fly   200 IYG---WNMTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSG--- 257
            .|.   :...| |||||...:: .|..|||:|.:.....:........||.| ..|.|...|   
  Fly   283 KYAHRHFGPRF-QICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITS-YGGPCGTIGWPS 345

  Fly   258 ILMDLLSYADWIKRVVR 274
            :......:..||:..:|
  Fly   346 VFTRTAKFYKWIRAHLR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 78/251 (31%)
Tryp_SPc 48..269 CDD:214473 76/248 (31%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 77/261 (30%)
Tryp_SPc 104..360 CDD:238113 79/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.