DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and f2

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_005169022.1 Gene:f2 / 325881 ZFINID:ZDB-GENE-030131-4606 Length:635 Species:Danio rerio


Alignment Length:316 Identity:78/316 - (24%)
Similarity:129/316 - (40%) Gaps:84/316 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EEDCG---IPHNISERSVN------------------AKLAQNPW--MAYLETPKGFHCSGTLIN 67
            |.|||   :...|::...|                  |::|..||  |.|..:|:...|..:||:
Zfish   343 ELDCGERPLFEKINKADKNEKELLMSYTGSRIVGGDEAEVASAPWQVMLYKRSPQELLCGASLIS 407

  Fly    68 HLFVLTAAHCV---P-------DDLLITVRLGEYN-TKTKVDCDNHLCQEPFQEYNVDMGFRHRY 121
            ..::||||||:   |       :|::  ||||::: ||.:...:..:.        :|....|..
Zfish   408 DEWILTAAHCILYPPWNKNFTINDII--VRLGKHSRTKYERGIEKIVA--------IDEIIVHPK 462

  Fly   122 YNANDQTN-DIGMLRLGRRVEYLNHIRPICI----------FASNRFQEPIDQLTWFTTTVW--- 172
            ||..:..| ||.:|.:.:.|.:.:.|.|:|:          ||..:.:          .|.|   
Zfish   463 YNWKENLNRDIALLHMKKPVVFTSEIHPVCLPTKSIAKNLMFAGYKGR----------VTGWGNL 517

  Fly   173 RET-AANATS--KVLRTMNIDRQPKETCSEIYGWNMTFEQICAG-----NTLSQLCSTDSGAPQI 229
            ||: .:|.|:  .||:.:::....:..|.......:|....|||     :.....|..|||.|.:
Zfish   518 RESWTSNPTNLPTVLQQIHLPIVDQSICRNSTSVIITDNMFCAGYQPDDSKRGDACEGDSGGPFV 582

  Fly   230 RKMWHNGSD-RYVQLGIASRVKGQCQNS---GILMDLLSYADWIKRVVRQYGPSTD 281
            .|   :.|| |:.|:||.|..:| |...   |....|.....|:|:|:.:.....|
Zfish   583 MK---SPSDNRWYQIGIVSWGEG-CDRDGKYGFYTHLFRMRRWMKKVIEKTDSGDD 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 68/262 (26%)
Tryp_SPc 48..269 CDD:214473 66/259 (25%)
f2XP_005169022.1 GLA 39..100 CDD:214503
KR 126..206 CDD:214527
KR 228..309 CDD:214527
Thrombin_light 326..373 CDD:286482 6/29 (21%)
Tryp_SPc 373..621 CDD:214473 68/271 (25%)
Tryp_SPc 374..625 CDD:238113 70/274 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.