DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG8952

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:247 Identity:62/247 - (25%)
Similarity:104/247 - (42%) Gaps:52/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PHNISERSV---NAKLAQNPWMAYLETP--KGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGE- 90
            |..|..|.|   :|||.|.||...|:..  ....|.|::|:..:|||||||......|.:..|. 
  Fly    31 PIKIDNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDTWVLTAAHCTNGLSSIFLMFGTV 95

  Fly    91 --YNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFA 153
              :|........|::...|  :||            :...||:.:::|...:.:..:|:.|.:. 
  Fly    96 DLFNANALNMTSNNIIIHP--DYN------------DKLNNDVSLIQLPEPLTFSANIQAIQLV- 145

  Fly   154 SNRFQEPIDQLTWFTTTV-----------WRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTF 207
             .::.:.||.:....|..           :.||...|..:::.  |.|      |..|||..:..
  Fly   146 -GQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIID--NAD------CVAIYGKYVVV 201

  Fly   208 EQ-ICA----GNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRV-KGQC 253
            :. :||    |:.:| .|:.|||.|.|  :::....::.|:||.|.| :.||
  Fly   202 DSTMCAKGFDGSDMS-TCTGDSGGPLI--LYNKTIQQWQQIGINSFVAEDQC 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 54/228 (24%)
Tryp_SPc 48..269 CDD:214473 54/228 (24%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 60/241 (25%)
Tryp_SPc 38..271 CDD:238113 59/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.